DMCA

MENU

جني المال

مواقع أخرى الإقليمية

نتائج البحث عن Healthy breakfast recipe

4 months ago

Quick and healthy breakfast recipe shorts quickbreakfast

Food Craving 7.9M مشاهدة
4 months ago

Healthy Breakfast recipe. Bottle gourd chapati (சுரைக்காய்)indhu bottlegourd chapati.

Indhu's home 7M مشاهدة
4 months ago

healthy breakfast recipe snacksrecipe easyrecipes healthybreakfast trending

Binita,s kitchen 971K مشاهدة
4 months ago

Tasty & healthy breakfast recipe 😋♥️//easy recipe//simple recipe//breakfast idea//👌🧅🥕😛.

Dipa's kitchen 7.5M مشاهدة
4 months ago

10 minutes healthy breakfast recipe you can make at home - LIVE STREAMING

Cooking Guy 2.4M مشاهدة
4 months ago

Healthy Breakfast Recipe

Tatyanna 5.8M مشاهدة
4 months ago

Beetroot Paratha Recipe |Healthy Breakfast Recipe | चुकंदर पराठा रेसिपी | Pinkis Kitchen And vlogs

Pinki's Kitchen and vlogs 3.9M مشاهدة
4 months ago

Healthy Breakfast Recipe| festival fasting weightloss

Cooking.Shorts 6.7M مشاهدة
4 months ago

Beetroot Mix Honey Recipe By Natural Recipes | Easy and Healthy Breakfast Recipe

Natural Recipes 3.5M مشاهدة
4 months ago

shorts Healthy breakfast recipe food vlog

pj homemaker quick recipes 724.4K مشاهدة
4 months ago

Healthy Breakfast Recipe🍓😋.shorts ashortaday youtubeshorts smoothie strawberry

food.chain94 5M مشاهدة
4 months ago

Weight loss Apple smoothie Recipe Healthy breakfast Weight loss Recipe

Ankita’s kitchen 2.4M مشاهدة
4 months ago

Healthy Breakfast recipe 🤤 trendingshorts trend cookingchannel cooking sorts indianfood

Tulis kitchen & Exclusive vlog 6.5M مشاهدة
4 months ago

healthy breakfast recipe/brocolli omelette cookingrecipe youtubeshorts food trending

BANTI का तड़का 1.8M مشاهدة
4 months ago

Best Recipe of Banana and Almond Paste | Nashta Recipe | Healthy Breakfast Recipe

AI Urdu 276.3K مشاهدة
4 months ago

dosa recipe/healthy breakfast recipes dosapizzahealthybreakfastdosastreetfood

Versatile Jaya 6.9M مشاهدة
4 months ago

Channa Dosa recipe | Instant Healthy Breakfast| Healthy Protein Dosa| Dinner recipes |Dosa Varieties

Maha's kitchen diary 7.8M مشاهدة
4 months ago

thalipeeth recipe thalipeeth quick and healthy breakfast recipes

All indian tadka 850.4K مشاهدة
4 months ago

Suji chilla recipe / Healthy breakfast recipe / Suji chilla kaise bnae short viral sujichilla

Cookingforbachelors 700.3K مشاهدة
4 months ago

10 Minutes Recipe | Quick And Easy Breakfast Recipe | Healthy Breakfast Recipe | Omelette Recipe

Tasty Dhaba. 798KViews 2.8M مشاهدة
4 months ago

shorts Suji ka Nashta | Healthy breakfast Sooji or dahi ka nashta recipe trendingshorts

Babita Nigam 02 2.6M مشاهدة
4 months ago

Egg into a tomatoe meal Simple and healthy breakfast recipe

Oblan Kitchen Tv 7.7M مشاهدة
4 months ago

Oats Appe | Quick Healthy Breakfast Recipe appam shorts asmr tiffinboxrecipe

Sumaiya Dastarkhwan 6.9M مشاهدة
4 months ago

Grand mothers healthy recipe - high protein breakfast - healthy breakfast - aaviri kudumu recipe

DishToDollars 5.3M مشاهدة
4 months ago

earliest healthy breakfast recipediabetic friendly breakfastfoxtail milletkhichadithinaimillet

7.5M مشاهدة
4 months ago

Easy and healthy breakfast recipe❤️❤️ ashortaday recipe food viral

Jaya sonar 3.1M مشاهدة
4 months ago

Healthy breakfast omelette egg breakfast health food youtubeshorts trending viral ytshorts

simply savoury 6M مشاهدة
4 months ago

Besan Se Banane Healthy Breakfast | बेसन का स्वादिष्ट नाश्ता viral shots recipe youtubeshorts

ATIDHANYA CREATIVITY 8M مشاهدة
4 months ago

Healthy breakfast recipe|Multi grain chillamultigrain amboliyoutubeshortsviralshortsshortreels

Pooja Pednekar's Kitchen 1.2M مشاهدة
4 months ago

healthy breakfast shorts viral breakfastrecipe

Meri Kitchen ?mera ghar 6.4M مشاهدة
4 months ago

Healthy Breakfast Recipe | Sprouts Salad Recipe | shorts cooking viral

5.5M مشاهدة
4 months ago

Moong dal ka healthy dosa try healthy breakfast recipe subscribe like share viral 👌😋👍

2.3M مشاهدة
4 months ago

todays healthy breakfast 😋🥚 egg 🐣 recipe 👌

julekha khatun 1.6M مشاهدة
4 months ago

instant breakfast recipe | झटपट होणारा नाश्ता | 10 mins healthy breakfast | shorts ytshortsनाश्ता

pournimashinde14 5M مشاهدة
4 months ago

Aloo Gobi Naan Recipe | पूरी पराठा खाना भुल जाओगे | Healthy Breakfast Recipe | Easy Gobi Paratha

Kitchen For You 1.6M مشاهدة
4 months ago

Healthy Breakfast Bowl healthybowl breakfastbowl breakfastrecipe

Paul 11 3.7M مشاهدة
4 months ago

morning healthy breakfast recipe ||rawa upma recipe rawaupma

Nanda unique creation 5.7M مشاهدة
4 months ago

ಬೆಳಗಿನ ಉಪಹಾರಕ್ಕೆ ಆರೋಗ್ಯಕರ ತಿಂಡಿ | Healthy breakfast recipe viral shorts

RASA VAIVIDHYA 5.7M مشاهدة
4 months ago

आलू मटर गाजर देसी पराठा | stuffed pratha recipe Healthy breakfast ideas aloo pratha

Manu ki Rasoi 2.5M مشاهدة
4 months ago

Healthy breakfast|Ragi kanji|shortsvideo shortsfeed shortstamil cooking healthy recipe shorts

Devi's living and loving 2M مشاهدة
4 months ago

یہ راز اپ کو کوئی نہیں بتائے گا |Healthy Breakfast Ideas|healthy instant breakfast ideas|BN food 3M|

BN Food 3M 6.8M مشاهدة
4 months ago

Healthy Breakfast Recipe 🤤🤤 besan ka vegetable cheela ytshorts trendingshorts

Taste Lucknowi 7.9M مشاهدة
4 months ago

10 minutes healthy breakfast recipe shortsyoutube foryou ytshorts viral shorts

Tahera's life 2.3M مشاهدة
4 months ago

Methi Thepla Recipe | How To Make Gujarati Methi na thepla | Healthy Breakfast Recipeshorts viral

Unbox Holistic Health 4.6M مشاهدة
4 months ago

Kerala Tasty & Healthy Breakfast - Puttu & Kadala Curry villagecookingkerala cooking indiancurry

Village Cooking - Kerala 3.7M مشاهدة
4 months ago

healthy breakfast recipe in 5 minutes|vegetables chila recipe healthy healthyfood

It's sant 5.9M مشاهدة
4 months ago

Minivlog126|Healthy Breakfastrecipedimldayinmylifevlogtamilcookingviraldietonlineshopping

Justlikeyoubyaishu 2.7M مشاهدة
4 months ago

moond dal paneer | katali /healthy breakfast recipe /मूंग दाल रेसिपी /sona rasoi

Sona Rasoi 6.7M مشاهدة
4 months ago

Vegetable Oats Idli Recipe | Healthy Breakfast Recipe trending shortsviral viral

FOOD Divine 337.5K مشاهدة
4 months ago

Healthy Breakfast recipe shorts breakfast millet Saamai khichdi Millet recipe trending minivlog

Me & Mine TAMIL 2.9M مشاهدة

عمليات البحث الأخيرة